PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013632344.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 223aa    MW: 24393.8 Da    PI: 8.4722
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013632344.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.53e-40451441100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++C+++pyf   +p kfa vhk+FGasnv+k+l ++pe +r da++slvyeA++r+rdPvyG++g i++lqqq++ l+ael 
  XP_013632344.1  45 PCAACKLLRRRCAQECPFSPYFSPCEPLKFASVHKVFGASNVSKMLMEVPEGQRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQALQAELT 139
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_013632344.1 140 AVRSE 144
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.13344145IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-4045142IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MSRERERLEE IGKKIKREAD AWPNQMAGIR RHISGPPGAL NTITPCAACK LLRRRCAQEC  60
PFSPYFSPCE PLKFASVHKV FGASNVSKML MEVPEGQRAD AANSLVYEAN VRLRDPVYGC  120
MGAISALQQQ VQALQAELTA VRSEILKYKQ REAVATLIVP SNSQYHNSGG VSVIALPPQT  180
PSTPPQPTAA HPPPPPSSCV YSQPTTRALE YGEIESENNS YFG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738440.0AB473844.1 Arabidopsis thaliana ASL11 mRNA for ASYMMETRIC LEAVES2-like 11 protein, complete cds.
GenBankBT0252880.0BT025288.1 Arabidopsis thaliana At2g40470 mRNA, complete cds.
GenBankDQ4466130.0DQ446613.1 Arabidopsis thaliana clone pENTR221-At2g40470 LOB domain protein 15/lateral organ boundaries domain protein 15 (At2g40470) mRNA, complete cds.
GenBankDQ6530510.0DQ653051.1 Arabidopsis thaliana clone 0000012791_0000009246 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013632344.11e-165PREDICTED: LOB domain-containing protein 15-like
SwissprotQ8L5T51e-121LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A0D3BNX61e-165A0A0D3BNX6_BRAOL; Uncharacterized protein
STRINGBra004572.1-P1e-163(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-114LOB domain-containing protein 15